PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02734g01013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TCP
Protein Properties Length: 165aa    MW: 17779.7 Da    PI: 11.0659
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02734g01013.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP109.93.8e-3483149672
                       TCP   6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssase 72 
                               ++++++hTkv+gR+RR+R++a+ aar+F+L++eLG+++d++ti+WLlq a+p+i+ +tgt+ ++a +
  Niben101Scf02734g01013.1  83 TSTKDRHTKVEGRGRRIRMPATGAARVFQLTRELGHKTDGETIQWLLQHAEPSIISATGTGITPAIA 149
                               689*********************************************************9999844 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.6E-2883149IPR005333Transcription factor, TCP
PROSITE profilePS5136925.30685139IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MESKNTNNIN KSYMAAPPSA RRKQVAPPIA TPLISLKQEP HDMAEKPPAL PIIKVTLPTP  60
TLKQSVSPPH LSPPPPPHNK AVTSTKDRHT KVEGRGRRIR MPATGAARVF QLTRELGHKT  120
DGETIQWLLQ HAEPSIISAT GTGITPAIAV SVNGTVEIPP LKMAL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009803790.12e-91PREDICTED: transcription factor TCP9-like
SwissprotO646472e-42TCP9_ARATH; Transcription factor TCP9
TrEMBLM1DWQ33e-51M1DWQ3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000956267e-51(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24824201
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.11e-41TCP family protein